PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100030720001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family HB-other
Protein Properties Length: 227aa    MW: 25761.7 Da    PI: 4.7148
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100030720001genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.61e-085193345
                                  --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHH CS
                      Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVk 45
                                  k+++++ eq+++Le+ Fe ++++  e++ +LA++lgL+ rq++
  Ote100030720001|100030720001 51 KKRRLSIEQVKALEKNFEVENKLEPERKVQLAQELGLQPRQIR 93
                                  5668999**********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.67E-83993IPR009057Homeodomain-like
PROSITE profilePS500719.1674693IPR001356Homeobox domain
SMARTSM003890.001849104IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.1E-94993IPR009057Homeodomain-like
PfamPF000464.7E-65193IPR001356Homeobox domain
CDDcd000864.74E-75193No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    Send to blast
MKRLNSSDSL GGFMSICPNA TDEHNPMYSR EFEAMLEEDC CLEESGRISE KKRRLSIEQV  60
KALEKNFEVE NKLEPERKVQ LAQELGLQPR QIRELKSKLH ENGESDKLKI GDEAEAENSN  120
GGKKGEIWPK FGDLKDGSSD SDSSAILNDE INNGSPREVL NGPSSSMKIS FEVGGMKEYQ  180
PQFVKIEEHN FFGEESQRED GGVNGDGWRG RVKKEKMLQD QFYYCKL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011097532.16e-58PREDICTED: homeobox-leucine zipper protein ATHB-6
TrEMBLA0A022R4P82e-50A0A022R4P8_ERYGU; Uncharacterized protein
STRINGVIT_07s0191g00180.t011e-41(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27182453